SCOPe 2.08: Domain d5nufb1: 5nuf B:4-156

Lineage for d5nufb1 (5nuf B:4-156)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries)

8. Domain d5nufb1: 5nuf B:4-156 [347190]
   Other proteins in same PDB: d5nufa2, d5nufb2, d5nufc2
   automated match to d5mdha1
   complexed with act, edo, fmt, gol, na, nad, peg, peo, so4

Details for d5nufb1

PDB Entry: 5nuf, 1.8 Å

PDB Description: cytosolic malate dehydrogenase 1

PDB Compounds: (B:) Malate dehydrogenase 1, cytoplasmic

SCOPe Domain Sequences for d5nufb1:

Sequence; same for both SEQRES and ATOM records:

>d5nufb1 c.2.1.0 (B:4-156) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
epvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelidaaf
pllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekhaap
nckvlvvanpantnalilkefapsipekniscl

Timeline for d5nufb1:

• d5nufb1 first appeared in SCOPe 2.07