SCOPe 2.08: Domain d5o3vb2: 5o3v B:439-724

Lineage for d5o3vb2 (5o3v B:439-724)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Vaccaria hispanica [TaxId:39387] [347033] (4 PDB entries)

8. Domain d5o3vb2: 5o3v B:439-724 [347188]
   Other proteins in same PDB: d5o3va1, d5o3vb1
   automated match to d1e8na2
   complexed with mg, so4

Details for d5o3vb2

PDB Entry: 5o3v, 2.17 Å

PDB Description: structural characterization of the fast and promiscuous macrocyclase from plant - pcy1-s562a bound to presegetalin b1

PDB Compounds: (B:) Peptide cyclase 1

SCOPe Domain Sequences for d5o3vb2:

Sequence; same for both SEQRES and ATOM records:

>d5o3vb2 c.69.1.0 (B:439-724) automated matches {Vaccaria hispanica [TaxId: 39387]}
drsefevkqvfvpskdgtkipifiaarkgisldgshpcemhgyggfginmmptfsasriv
flkhlggvfclanirgggeygeewhkagfrdkkqnvfddfisaaeylissgytkarrvai
egganggllvaacinqrpdlfgcaeancgvmdmlrfhkftlgylwtgdygcsdkeeefkw
likyspihnvrrpweqpgneetqypatmiltadhddrvvplhsfkllatmqhvlctsled
spqknpiiariqrkaahygratmtqiaevadrygfmakaleapwid

Timeline for d5o3vb2:

• d5o3vb2 first appeared in SCOPe 2.07