![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
![]() | Protein automated matches [190170] (17 species) not a true protein |
![]() | Species Hypocrea atroviridis [TaxId:452589] [347054] (2 PDB entries) |
![]() | Domain d5o5db1: 5o5d B:2-430 [347171] Other proteins in same PDB: d5o5da2, d5o5db2 automated match to d1q2ba_ complexed with btb, cl, gol, nag, ni, peg |
PDB Entry: 5o5d (more details), 1.72 Å
SCOPe Domain Sequences for d5o5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o5db1 b.29.1.10 (B:2-430) automated matches {Hypocrea atroviridis [TaxId: 452589]} qvcttqaethpalswskctsggscttqagkvvldanwrwthaypsgnncyngntwdatlc pddatcakncclegadysgtygvttsgnqltidfvtqsanknvgarlylmasdtayeeft llnnefsfdvdvsalpcglngalyfvsmdadggaskyptnlagakygtgycdsqcprdlk fisgqanvegwqpssnnantgigghgsccsemdiweansisqaltphpcetvgqvtcsgd dcggtysnnryggtcdpdgcdwnpyrlgnhtfygpgsgftvdttkkitvvtqfsstginr yyvqngvkfvqpnasglsgytgntinsaycsaeqtafggtsftdkggltqmnkalsggmv lvlslwddyaanmlwldstyptndtastpgaargtcstssgvpatveqqspnskvvfsni kfgpigstg
Timeline for d5o5db1: