Lineage for d5o5db1 (5o5d B:2-430)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780019Species Hypocrea atroviridis [TaxId:452589] [347054] (2 PDB entries)
  8. 2780021Domain d5o5db1: 5o5d B:2-430 [347171]
    Other proteins in same PDB: d5o5da2, d5o5db2
    automated match to d1q2ba_
    complexed with btb, cl, gol, nag, ni, peg

Details for d5o5db1

PDB Entry: 5o5d (more details), 1.72 Å

PDB Description: cellobiohydrolase cel7a from t. atroviride
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5o5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o5db1 b.29.1.10 (B:2-430) automated matches {Hypocrea atroviridis [TaxId: 452589]}
qvcttqaethpalswskctsggscttqagkvvldanwrwthaypsgnncyngntwdatlc
pddatcakncclegadysgtygvttsgnqltidfvtqsanknvgarlylmasdtayeeft
llnnefsfdvdvsalpcglngalyfvsmdadggaskyptnlagakygtgycdsqcprdlk
fisgqanvegwqpssnnantgigghgsccsemdiweansisqaltphpcetvgqvtcsgd
dcggtysnnryggtcdpdgcdwnpyrlgnhtfygpgsgftvdttkkitvvtqfsstginr
yyvqngvkfvqpnasglsgytgntinsaycsaeqtafggtsftdkggltqmnkalsggmv
lvlslwddyaanmlwldstyptndtastpgaargtcstssgvpatveqqspnskvvfsni
kfgpigstg

SCOPe Domain Coordinates for d5o5db1:

Click to download the PDB-style file with coordinates for d5o5db1.
(The format of our PDB-style files is described here.)

Timeline for d5o5db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o5db2