Lineage for d1auob_ (1auo B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26827Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (2 proteins)
  6. 26832Protein Carboxylesterase [53548] (1 species)
  7. 26833Species Pseudomonas fluorescens [TaxId:294] [53549] (2 PDB entries)
  8. 26835Domain d1auob_: 1auo B: [34717]

Details for d1auob_

PDB Entry: 1auo (more details), 1.8 Å

PDB Description: carboxylesterase from pseudomonas fluorescens

SCOP Domain Sequences for d1auob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auob_ c.69.1.14 (B:) Carboxylesterase {Pseudomonas fluorescens}
mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg

SCOP Domain Coordinates for d1auob_:

Click to download the PDB-style file with coordinates for d1auob_.
(The format of our PDB-style files is described here.)

Timeline for d1auob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1auoa_