| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5o5ga3: 5o5g A:261-349 [347153] Other proteins in same PDB: d5o5ga5 automated match to d4c4ko1 complexed with nag |
PDB Entry: 5o5g (more details), 3.03 Å
SCOPe Domain Sequences for d5o5ga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o5ga3 b.1.1.0 (A:261-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpsfvkrpsnlavtvddsaefkceargdpvptvrwrkddgelpksryeirddhtlkirkv
tagdmgsytcvaenmvgkaeasatltvqe
Timeline for d5o5ga3:
View in 3DDomains from same chain: (mouse over for more information) d5o5ga1, d5o5ga2, d5o5ga4, d5o5ga5 |