| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Vaccaria hispanica [TaxId:39387] [347033] (4 PDB entries) |
| Domain d5o3xa2: 5o3x A:439-724 [347145] Other proteins in same PDB: d5o3xa1, d5o3xb1 automated match to d1e8na2 complexed with cac |
PDB Entry: 5o3x (more details), 2.55 Å
SCOPe Domain Sequences for d5o3xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o3xa2 c.69.1.0 (A:439-724) automated matches {Vaccaria hispanica [TaxId: 39387]}
drsefevkqvfvpskdgtkipifiaarkgisldgshpcemhgyggfginmmptfsasriv
flkhlggvfclanirgggeygeewhkagfrdkkqnvfddfisaaeylissgytkarrvai
eggsnggllvaacinqrpdlfgcaeancgvmdmlrfhkftlgylwtgdygcsdkeeefkw
likyspihnvrrpweqpgneetqypatmiltadhddrvvplhsfkllatmqhvlctsled
spqknpiiariqrkaahygratmtqiaevadrygfmakaleapwid
Timeline for d5o3xa2: