Lineage for d1eh5a_ (1eh5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151601Family c.69.1.13: Thioesterases [53542] (4 proteins)
  6. 2151606Protein Palmitoyl protein thioesterase 1 [53545] (1 species)
  7. 2151607Species Cow (Bos taurus) [TaxId:9913] [53546] (3 PDB entries)
  8. 2151609Domain d1eh5a_: 1eh5 A: [34714]
    complexed with ndg, plm

Details for d1eh5a_

PDB Entry: 1eh5 (more details), 2.5 Å

PDB Description: crystal structure of palmitoyl protein thioesterase 1 complexed with palmitate
PDB Compounds: (A:) palmitoyl protein thioesterase 1

SCOPe Domain Sequences for d1eh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh5a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}
dppaplplviwhgmgdsccnplsmgaikkmvekkipgihvlsleigktlredvensffln
vnsqvttvcqilakdpklqqgynamgfsqggqflravaqrcpsppmvnlisvggqhqgvf
glprcpgesshicdfirktlnagaynkaiqerlvqaeywhdpirediyrnhsifladinq
ergvnesykknlmalkkfvmvkflndtivdpvdsewfgfyrsgqaketiplqestlytqd
rlglkamdkagqlvflalegdhlqlseewfyahiipfle

SCOPe Domain Coordinates for d1eh5a_:

Click to download the PDB-style file with coordinates for d1eh5a_.
(The format of our PDB-style files is described here.)

Timeline for d1eh5a_: