Lineage for d5n1ga_ (5n1g A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586596Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2586642Species Cricetulus griseus [TaxId:10029] [346668] (32 PDB entries)
  8. 2586645Domain d5n1ga_: 5n1g A: [347139]
    automated match to d1smha_
    complexed with 8g5, dms, mpd, mrd

Details for d5n1ga_

PDB Entry: 5n1g (more details), 1.14 Å

PDB Description: camp-dependent protein kinase a from cricetulus griseus in complex with fragment like molecule 4-(2-amino-1,3-thiazol-4-yl)-1- oxaspiro[4.5]decan-2-one
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d5n1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n1ga_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cricetulus griseus [TaxId: 10029]}
eqesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrvmlvkhketgnhya
mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfs
hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakr
vkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki
vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv
eapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d5n1ga_:

Click to download the PDB-style file with coordinates for d5n1ga_.
(The format of our PDB-style files is described here.)

Timeline for d5n1ga_: