Lineage for d5nrkb_ (5nrk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347539Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2347540Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2347558Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2347559Protein automated matches [190928] (7 species)
    not a true protein
  7. 2347560Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries)
  8. 2347562Domain d5nrkb_: 5nrk B: [347119]
    Other proteins in same PDB: d5nrka1, d5nrka2, d5nrkc1, d5nrkc2
    automated match to d4uyqb_
    complexed with ca, gol, scn; mutant

Details for d5nrkb_

PDB Entry: 5nrk (more details), 1.45 Å

PDB Description: crystal structure of the sixth cohesin from acetivibrio cellulolyticus' scaffoldin b in complex with cel5 dockerin s15i, i16n mutant
PDB Compounds: (B:) DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S15I, I16N mutant

SCOPe Domain Sequences for d5nrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nrkb_ a.139.1.0 (B:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
kpgdvdgngsinindfalmrnyllgnlkdfpaeddikagdlngdksinsldfaimrmyll
gmitkfsv

SCOPe Domain Coordinates for d5nrkb_:

Click to download the PDB-style file with coordinates for d5nrkb_.
(The format of our PDB-style files is described here.)

Timeline for d5nrkb_: