Lineage for d1thta_ (1tht A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26817Family c.69.1.13: Thioesterases [53542] (2 proteins)
  6. 26818Protein Myristoyl-ACP-specific thioesterase [53543] (1 species)
  7. 26819Species Vibrio harveyi [TaxId:669] [53544] (1 PDB entry)
  8. 26820Domain d1thta_: 1tht A: [34711]

Details for d1thta_

PDB Entry: 1tht (more details), 2.1 Å

PDB Description: structure of a myristoyl-acp-specific thioesterase from vibrio harveyi

SCOP Domain Sequences for d1thta_:

Sequence, based on SEQRES records: (download)

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi}
qcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylstngf
hvfrydslhhvglssgsideftmttgknslctvyhwlqtkgtqnigliaaslsarvayev
isdlelsflitavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrdcfe
hhwdtldstldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgsshdl
genlvvlrnfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpe
ma

Sequence, based on observed residues (ATOM records): (download)

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi}
qcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylstngf
hvfrydslhhveftmttgknslctvyhwlqtkgtqnigliaaslsarvayevisdlelsf
litavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrdcfehhwdtlds
tldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgsshdlgenlvvlr
nfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpema

SCOP Domain Coordinates for d1thta_:

Click to download the PDB-style file with coordinates for d1thta_.
(The format of our PDB-style files is described here.)

Timeline for d1thta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1thtb_