Lineage for d1thta_ (1tht A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135022Family c.69.1.13: Thioesterases [53542] (4 protein domains)
  6. 2135023Protein Myristoyl-ACP-specific thioesterase [53543] (1 species)
  7. 2135024Species Vibrio harveyi [TaxId:669] [53544] (1 PDB entry)
  8. 2135025Domain d1thta_: 1tht A: [34711]

Details for d1thta_

PDB Entry: 1tht (more details), 2.1 Å

PDB Description: structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
PDB Compounds: (A:) thioesterase

SCOPe Domain Sequences for d1thta_:

Sequence, based on SEQRES records: (download)

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}
qcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylstngf
hvfrydslhhvglssgsideftmttgknslctvyhwlqtkgtqnigliaaslsarvayev
isdlelsflitavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrdcfe
hhwdtldstldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgsshdl
genlvvlrnfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpe
ma

Sequence, based on observed residues (ATOM records): (download)

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}
qcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylstngf
hvfrydslhhveftmttgknslctvyhwlqtkgtqnigliaaslsarvayevisdlelsf
litavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrdcfehhwdtlds
tldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgsshdlgenlvvlr
nfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpema

SCOPe Domain Coordinates for d1thta_:

Click to download the PDB-style file with coordinates for d1thta_.
(The format of our PDB-style files is described here.)

Timeline for d1thta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1thtb_