| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein automated matches [227005] (6 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [346973] (3 PDB entries) |
| Domain d5o28a2: 5o28 A:123-286 [347107] Other proteins in same PDB: d5o28a1, d5o28b1, d5o28b3, d5o28c1, d5o28d1, d5o28d3 automated match to d1b0aa1 |
PDB Entry: 5o28 (more details), 1.89 Å
SCOPe Domain Sequences for d5o28a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o28a2 c.2.1.7 (A:123-286) automated matches {Escherichia coli [TaxId: 83333]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpq
Timeline for d5o28a2: