SCOPe 2.07: Domain d5mzmd2: 5mzm D:182-276

Lineage for d5mzmd2 (5mzm D:182-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d5mzmd2: 5mzm D:182-276 [347105]
   Other proteins in same PDB: d5mzma1, d5mzmb_, d5mzmd1, d5mzme_
   automated match to d1n5aa1
   complexed with gol, so4

Details for d5mzmd2

PDB Entry: 5mzm, 2.4 Å

PDB Description: structure of h-2db in complex with teipp apl trh4 p3p

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5mzmd2:

Sequence, based on SEQRES records:

>d5mzmd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Sequence, based on observed residues (ATOM records):

>d5mzmd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeetqdmelvetrpagdgtfq
kwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d5mzmd2:

• d5mzmd2 is new in SCOPe 2.07-stable
  
• d5mzmd2 appears in the current release, SCOPe 2.08