![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d5mzmd2: 5mzm D:182-276 [347105] Other proteins in same PDB: d5mzma1, d5mzmb_, d5mzmd1, d5mzme_ automated match to d1n5aa1 complexed with gol, so4 |
PDB Entry: 5mzm (more details), 2.4 Å
SCOPe Domain Sequences for d5mzmd2:
Sequence, based on SEQRES records: (download)
>d5mzmd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrwep
>d5mzmd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeetqdmelvetrpagdgtfq kwasvvvplgkeqnytcrvyheglpepltlrwep
Timeline for d5mzmd2:
![]() Domains from other chains: (mouse over for more information) d5mzma1, d5mzma2, d5mzmb_, d5mzme_ |