Lineage for d5mzmd2 (5mzm D:182-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747261Domain d5mzmd2: 5mzm D:182-276 [347105]
    Other proteins in same PDB: d5mzma1, d5mzmb_, d5mzmd1, d5mzme_
    automated match to d1n5aa1
    complexed with gol, so4

Details for d5mzmd2

PDB Entry: 5mzm (more details), 2.4 Å

PDB Description: structure of h-2db in complex with teipp apl trh4 p3p
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5mzmd2:

Sequence, based on SEQRES records: (download)

>d5mzmd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Sequence, based on observed residues (ATOM records): (download)

>d5mzmd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeetqdmelvetrpagdgtfq
kwasvvvplgkeqnytcrvyheglpepltlrwep

SCOPe Domain Coordinates for d5mzmd2:

Click to download the PDB-style file with coordinates for d5mzmd2.
(The format of our PDB-style files is described here.)

Timeline for d5mzmd2: