SCOPe 2.07: Domain d5mzmd1: 5mzm D:1-181

Lineage for d5mzmd1 (5mzm D:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)

8. Domain d5mzmd1: 5mzm D:1-181 [347104]
   Other proteins in same PDB: d5mzma2, d5mzmb_, d5mzmd2, d5mzme_
   automated match to d1n5aa2
   complexed with gol, so4

Details for d5mzmd1

PDB Entry: 5mzm, 2.4 Å

PDB Description: structure of h-2db in complex with teipp apl trh4 p3p

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5mzmd1:

Sequence, based on SEQRES records:

>d5mzmd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Sequence, based on observed residues (ATOM records):

>d5mzmd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylknglr

Timeline for d5mzmd1:

• d5mzmd1 is new in SCOPe 2.07-stable
  
• d5mzmd1 appears in the current release, SCOPe 2.08