Lineage for d5o2aa1 (5o2a A:2-122)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498288Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
    automatically mapped to Pfam PF00763
  6. 2498308Protein automated matches [346970] (2 species)
    not a true protein
  7. 2498309Species Escherichia coli [TaxId:83333] [346971] (3 PDB entries)
  8. 2498310Domain d5o2aa1: 5o2a A:2-122 [347091]
    Other proteins in same PDB: d5o2aa2, d5o2ab2, d5o2ab3, d5o2ac2, d5o2ad2
    automated match to d1b0aa2

Details for d5o2aa1

PDB Entry: 5o2a (more details), 1.9 Å

PDB Description: fold q98h
PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d5o2aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2aa1 c.58.1.2 (A:2-122) automated matches {Escherichia coli [TaxId: 83333]}
aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev
gfvsrsydlpettseaellelidtlnadntidgilvhlplpagidnvkvlerihpdkdvd
g

SCOPe Domain Coordinates for d5o2aa1:

Click to download the PDB-style file with coordinates for d5o2aa1.
(The format of our PDB-style files is described here.)

Timeline for d5o2aa1: