SCOP 1.73: Domain d1a88c_: 1a88 C:

Lineage for d1a88c_ (1a88 C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (7 proteins)

6. Protein Chloroperoxidase L [53538] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [53539] (1 PDB entry)

8. Domain d1a88c_: 1a88 C: [34709]

Details for d1a88c_

PDB Entry: 1a88, 1.9 Å

PDB Description: chloroperoxidase l

PDB Compounds: (C:) chloroperoxidase l

SCOP Domain Sequences for d1a88c_:

Sequence; same for both SEQRES and ATOM records:

>d1a88c_ c.69.1.12 (C:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}
gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
llanatlksyeglphgmlsthpevlnpdllafvks

Timeline for d1a88c_:

• d1a88c_ first appeared (with stable ids) in SCOP 1.55
  
• d1a88c_ appears in SCOP 1.71
  
• d1a88c_ appears in SCOP 1.75
  
• d1a88c_ appears in the current release, SCOPe 2.08