Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (7 proteins) |
Protein Chloroperoxidase L [53538] (1 species) |
Species Streptomyces lividans [TaxId:1916] [53539] (1 PDB entry) |
Domain d1a88c_: 1a88 C: [34709] |
PDB Entry: 1a88 (more details), 1.9 Å
SCOP Domain Sequences for d1a88c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a88c_ c.69.1.12 (C:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae llanatlksyeglphgmlsthpevlnpdllafvks
Timeline for d1a88c_: