Lineage for d5o59b_ (5o59 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780019Species Hypocrea atroviridis [TaxId:452589] [347054] (2 PDB entries)
  8. 2780023Domain d5o59b_: 5o59 B: [347081]
    automated match to d1q2ba_
    complexed with btb, glc, gol, gs1, nag, ni, peg

Details for d5o59b_

PDB Entry: 5o59 (more details), 1.75 Å

PDB Description: cellobiohydrolase cel7a from t. atroviride
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5o59b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o59b_ b.29.1.10 (B:) automated matches {Hypocrea atroviridis [TaxId: 452589]}
eqvcttqaethpalswskctsggscttqagkvvldanwrwthaypsgnncyngntwdatl
cpddatcakncclegadysgtygvttsgnqltidfvtqsanknvgarlylmasdtayeef
tllnnefsfdvdvsalpcglngalyfvsmdadggaskyptnlagakygtgycdsqcprdl
kfisgqanvegwqpssnnantgigghgsccsemdiweansisqaltphpcetvgqvtcsg
ddcggtysnnryggtcdpdgcdwnpyrlgnhtfygpgsgftvdttkkitvvtqfsstgin
ryyvqngvkfvqpnasglsgytgntinsaycsaeqtafggtsftdkggltqmnkalsggm
vlvlslwddyaanmlwldstyptndtastpgaargtcstssgvpatveqqspnskvvfsn
ikfgpigstg

SCOPe Domain Coordinates for d5o59b_:

Click to download the PDB-style file with coordinates for d5o59b_.
(The format of our PDB-style files is described here.)

Timeline for d5o59b_: