![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
![]() | Protein automated matches [190170] (17 species) not a true protein |
![]() | Species Hypocrea atroviridis [TaxId:452589] [347054] (2 PDB entries) |
![]() | Domain d5o59b_: 5o59 B: [347081] automated match to d1q2ba_ complexed with btb, glc, gol, gs1, nag, ni, peg |
PDB Entry: 5o59 (more details), 1.75 Å
SCOPe Domain Sequences for d5o59b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o59b_ b.29.1.10 (B:) automated matches {Hypocrea atroviridis [TaxId: 452589]} eqvcttqaethpalswskctsggscttqagkvvldanwrwthaypsgnncyngntwdatl cpddatcakncclegadysgtygvttsgnqltidfvtqsanknvgarlylmasdtayeef tllnnefsfdvdvsalpcglngalyfvsmdadggaskyptnlagakygtgycdsqcprdl kfisgqanvegwqpssnnantgigghgsccsemdiweansisqaltphpcetvgqvtcsg ddcggtysnnryggtcdpdgcdwnpyrlgnhtfygpgsgftvdttkkitvvtqfsstgin ryyvqngvkfvqpnasglsgytgntinsaycsaeqtafggtsftdkggltqmnkalsggm vlvlslwddyaanmlwldstyptndtastpgaargtcstssgvpatveqqspnskvvfsn ikfgpigstg
Timeline for d5o59b_: