Lineage for d5n2kg2 (5n2k G:113-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751066Domain d5n2kg2: 5n2k G:113-213 [347069]
    Other proteins in same PDB: d5n2ka1, d5n2kc1, d5n2ke1, d5n2kg1, d5n2ki1, d5n2kk1, d5n2km1, d5n2ko1
    automated match to d1aqkl2
    complexed with edo

Details for d5n2kg2

PDB Entry: 5n2k (more details), 2.22 Å

PDB Description: structure of unbound briakinumab fab
PDB Compounds: (G:) Briakinumab FAb light chain

SCOPe Domain Sequences for d5n2kg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2kg2 b.1.1.2 (G:113-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5n2kg2:

Click to download the PDB-style file with coordinates for d5n2kg2.
(The format of our PDB-style files is described here.)

Timeline for d5n2kg2: