Lineage for d5o10b_ (5o10 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304027Species Human (Homo sapiens) [TaxId:9606] [109644] (12 PDB entries)
    Uniprot P99999
  8. 3047000Domain d5o10b_: 5o10 B: [347062]
    automated match to d5exqa_
    complexed with hec; mutant

Details for d5o10b_

PDB Entry: 5o10 (more details), 1.36 Å

PDB Description: y48h mutant of human cytochrome c
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d5o10b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o10b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d5o10b_:

Click to download the PDB-style file with coordinates for d5o10b_.
(The format of our PDB-style files is described here.)

Timeline for d5o10b_:

  • d5o10b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06