Lineage for d1a7ub_ (1a7u B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900586Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2900611Protein Chloroperoxidase T [53536] (1 species)
  7. 2900612Species Streptomyces aureofaciens [TaxId:1894] [53537] (2 PDB entries)
  8. 2900616Domain d1a7ub_: 1a7u B: [34706]

Details for d1a7ub_

PDB Entry: 1a7u (more details), 1.75 Å

PDB Description: chloroperoxidase t
PDB Compounds: (B:) chloroperoxidase t

SCOPe Domain Sequences for d1a7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7ub_ c.69.1.12 (B:) Chloroperoxidase T {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgagqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
flaslepfllktddnpdgaapkeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak

SCOPe Domain Coordinates for d1a7ub_:

Click to download the PDB-style file with coordinates for d1a7ub_.
(The format of our PDB-style files is described here.)

Timeline for d1a7ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7ua_