SCOPe 2.07: Domain d1a7ub_: 1a7u B:

Lineage for d1a7ub_ (1a7u B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (8 protein domains)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein Chloroperoxidase T [53536] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53537] (2 PDB entries)

8. Domain d1a7ub_: 1a7u B: [34706]

Details for d1a7ub_

PDB Entry: 1a7u, 1.75 Å

PDB Description: chloroperoxidase t

PDB Compounds: (B:) chloroperoxidase t

SCOPe Domain Sequences for d1a7ub_:

Sequence; same for both SEQRES and ATOM records:

>d1a7ub_ c.69.1.12 (B:) Chloroperoxidase T {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgagqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
flaslepfllktddnpdgaapkeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak

Timeline for d1a7ub_:

• d1a7ub_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7ub_ appears in SCOPe 2.06