| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
| Protein automated matches [190376] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries) |
| Domain d5n7ca_: 5n7c A: [347056] automated match to d5ezpe_ complexed with act, cu, edo, peg |
PDB Entry: 5n7c (more details), 2.45 Å
SCOPe Domain Sequences for d5n7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n7ca_ b.3.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
Timeline for d5n7ca_: