Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (8 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
Protein Bromoperoxidase A1 [53534] (1 species) |
Species Streptomyces aureofaciens [TaxId:1894] [53535] (1 PDB entry) |
Domain d1a8qa_: 1a8q A: [34702] |
PDB Entry: 1a8q (more details), 1.75 Å
SCOPe Domain Sequences for d1a8qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} picttrdgveifykdwgqgrpvvfihgwplngdawqdqlkavvdagyrgiahdrrghghs tpvwdgydfdtfaddlndlltdldlrdvtlvahsmgggelaryvgrhgtgrlrsavllsa ippvmiksdknpdgvpdevfdalkngvltersqfwkdtaegffsanrpgnkvtqgnkdaf wymamaqtieggvrcvdafgytdftedlkkfdiptlvvhgdddqvvpidatgrksaqiip naelkvyegsshgiamvpgdkekfnrdlleflnk
Timeline for d1a8qa_: