SCOPe 2.06: Domain d1a8qa_: 1a8q A:

Lineage for d1a8qa_ (1a8q A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein Bromoperoxidase A1 [53534] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53535] (1 PDB entry)

8. Domain d1a8qa_: 1a8q A: [34702]

Details for d1a8qa_

PDB Entry: 1a8q, 1.75 Å

PDB Description: bromoperoxidase a1

PDB Compounds: (A:) bromoperoxidase a1

SCOPe Domain Sequences for d1a8qa_:

Sequence; same for both SEQRES and ATOM records:

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}
picttrdgveifykdwgqgrpvvfihgwplngdawqdqlkavvdagyrgiahdrrghghs
tpvwdgydfdtfaddlndlltdldlrdvtlvahsmgggelaryvgrhgtgrlrsavllsa
ippvmiksdknpdgvpdevfdalkngvltersqfwkdtaegffsanrpgnkvtqgnkdaf
wymamaqtieggvrcvdafgytdftedlkkfdiptlvvhgdddqvvpidatgrksaqiip
naelkvyegsshgiamvpgdkekfnrdlleflnk

Timeline for d1a8qa_:

• d1a8qa_ first appeared (with stable ids) in SCOP 1.55, called d1a8q__
  
• d1a8qa_ appears in SCOPe 2.05
  
• d1a8qa_ appears in SCOPe 2.07
  
• d1a8qa_ appears in the current release, SCOPe 2.08