SCOPe 2.07: Domain d5mzfb1: 5mzf B:1-156

Lineage for d5mzfb1 (5mzf B:1-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (6 species)
   not a true protein

7. Species Canis lupus [TaxId:9615] [347014] (1 PDB entry)

8. Domain d5mzfb1: 5mzf B:1-156 [347015]
   Other proteins in same PDB: d5mzfb2
   automated match to d1irya_
   complexed with act, cl, gol, so4

Details for d5mzfb1

PDB Entry: 5mzf, 2 Å

PDB Description: crystal structure of dog mth1 protein

PDB Compounds: (B:) MTH1 protein

SCOPe Domain Sequences for d5mzfb1:

Sequence; same for both SEQRES and ATOM records:

>d5mzfb1 d.113.1.1 (B:1-156) automated matches {Canis lupus [TaxId: 9615]}
mgtsrlytlvlvlqpervllgmkkrgfgagrwngfggkvqegetiedgakrelreesglt
vdtlhkvgqimfefvgepelmdvhifctdsvqgtpvesdemrpqwfqldqipftdmwpdd
sywfplllqkkkfhgyfrfqgpntildytlrevdkl

Timeline for d5mzfb1:

• d5mzfb1 is new in SCOPe 2.07-stable
  
• d5mzfb1 appears in the current release, SCOPe 2.08