![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins) automatically mapped to Pfam PF00763 |
![]() | Protein automated matches [346970] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [346971] (3 PDB entries) |
![]() | Domain d5o28c1: 5o28 C:2-122 [347003] Other proteins in same PDB: d5o28a2, d5o28b2, d5o28b3, d5o28c2, d5o28d2, d5o28d3 automated match to d1b0aa2 |
PDB Entry: 5o28 (more details), 1.89 Å
SCOPe Domain Sequences for d5o28c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o28c1 c.58.1.2 (C:2-122) automated matches {Escherichia coli [TaxId: 83333]} aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev gfvsrsydlpettseaellelidtlnadntidgilvqlplpagidnvkvlerihpdkdvd g
Timeline for d5o28c1: