Lineage for d1brta_ (1brt A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 707081Family c.69.1.12: Haloperoxidase [53531] (7 proteins)
  6. 707093Protein Bromoperoxidase A2 [53532] (1 species)
  7. 707094Species Streptomyces aureofaciens [TaxId:1894] [53533] (2 PDB entries)
  8. 707095Domain d1brta_: 1brt A: [34699]
    complexed with cl; mutant

Details for d1brta_

PDB Entry: 1brt (more details), 1.5 Å

PDB Description: bromoperoxidase a2 mutant m99t
PDB Compounds: (A:) bromoperoxidase a2

SCOP Domain Sequences for d1brta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfstgtgevaryvssygtariakva
flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak

SCOP Domain Coordinates for d1brta_:

Click to download the PDB-style file with coordinates for d1brta_.
(The format of our PDB-style files is described here.)

Timeline for d1brta_: