Lineage for d5nwsa_ (5nws A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (81 species)
    not a true protein
  7. 2332147Species Streptomyces antibioticus [TaxId:1890] [279042] (4 PDB entries)
  8. 3046927Domain d5nwsa_: 5nws A: [346989]
    automated match to d2x5wa_
    complexed with gol, hem, pg4

Details for d5nwsa_

PDB Entry: 5nws (more details), 2.23 Å

PDB Description: crystal structure of saacmm involved in actinomycin biosynthesis
PDB Compounds: (A:) saAcmM

SCOPe Domain Sequences for d5nwsa_:

Sequence, based on SEQRES records: (download)

>d5nwsa_ a.104.1.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
agphmmdpdlladpftgygrlrergpvvrgrfvdgtpvwfvtryddvravlrdprfvntp
spvpgeggadpregmmdllnvpeplrvyllgsildsdppdhprlrrlvtrafaarrilgl
rpgieriadrllaelprreeedgtvdllehfayplsitvicelvgipatdlerwrewggd
lvsmrperlrhsfpvmidychrlieqrraaltddllseliraqdddggrlsdietvtmil
tlvlaghetsahligngtaallthpgqwallrkdpallpravhelmrwcgsvhvarlrya
tedlelagtpvargdavqlvlvsanfdprhysdpdrlditrhqegqaenhvgfghgihyc
lgatlarqegevalarlletypdlaladgdpevrrarlpgswrldalrlrlrp

Sequence, based on observed residues (ATOM records): (download)

>d5nwsa_ a.104.1.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
agphmmdpdlladpftgygrlrergpvvrgrfvdgtpvwfvtryddvravlrdprfvntp
snvpeplrvyllgsildsdppdhprlrrlvtrafaarrilglrpgieriadrllaelprr
eeedgtvdllehfayplsitvicelvgipatdlerwrewggdlvsmrperlrhsfpvmid
ychrlieqrraaltddllseliraqdddggrlsdietvtmiltlvlaghetsahligngt
aallthpgqwallrkdpallpravhelmrwcgsvhvarlryatedlelagtpvargdavq
lvlvsanfdprhysdpdrlditrhqegqaenhvgfghgihyclgatlarqegevalarll
etypdlaladgdpevrrarlpgswrldalrlrlrp

SCOPe Domain Coordinates for d5nwsa_:

Click to download the PDB-style file with coordinates for d5nwsa_.
(The format of our PDB-style files is described here.)

Timeline for d5nwsa_:

  • d5nwsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06