Lineage for d5mnsc_ (5mns C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (81 species)
    not a true protein
  7. 2332147Species Streptomyces antibioticus [TaxId:1890] [279042] (4 PDB entries)
  8. 3046926Domain d5mnsc_: 5mns C: [346988]
    automated match to d3a4ha_
    complexed with deb, hem

Details for d5mnsc_

PDB Entry: 5mns (more details), 2.62 Å

PDB Description: structural and functional characterization of olep in complex with 6deb in sodium formate
PDB Compounds: (C:) Cytochrome P-450

SCOPe Domain Sequences for d5mnsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mnsc_ a.104.1.0 (C:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
lvrrfptldlaepvaglkwkqgmlirglerqivsw

SCOPe Domain Coordinates for d5mnsc_:

Click to download the PDB-style file with coordinates for d5mnsc_.
(The format of our PDB-style files is described here.)

Timeline for d5mnsc_:

  • d5mnsc_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06