SCOPe 2.07: Domain d5ndbb_: 5ndb B:

Lineage for d5ndbb_ (5ndb B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)

8. Domain d5ndbb_: 5ndb B: [346987]
   automated match to d4bp0a_
   complexed with 8tw, cl, dms, gol, so4, trs, zn

Details for d5ndbb_

PDB Entry: 5ndb, 2.38 Å

PDB Description: crystal structure of metallo-beta-lactamase spm-1 complexed with cyclobutanone inhibitor

PDB Compounds: (B:) beta-lactamase imp-1

SCOPe Domain Sequences for d5ndbb_:

Sequence; same for both SEQRES and ATOM records:

>d5ndbb_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfyssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk
nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf
ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav
gemrl

Timeline for d5ndbb_:

• d5ndbb_ is new in SCOPe 2.07-stable
  
• d5ndbb_ appears in the current release, SCOPe 2.08