Lineage for d1qo7b_ (1qo7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134816Family c.69.1.11: Epoxide hydrolase [53525] (3 protein domains)
  6. 2134817Protein Bacterial epoxide hydrolase [53528] (2 species)
  7. 2134823Species Aspergillus niger [TaxId:5061] [53530] (3 PDB entries)
  8. 2134827Domain d1qo7b_: 1qo7 B: [34698]

Details for d1qo7b_

PDB Entry: 1qo7 (more details), 1.8 Å

PDB Description: structure of aspergillus niger epoxide hydrolase
PDB Compounds: (B:) epoxide hydrolase

SCOPe Domain Sequences for d1qo7b_:

Sequence, based on SEQRES records: (download)

>d1qo7b_ c.69.1.11 (B:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}
kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
ltesfpraihtyrettptasapngatmlqkelyihkpfgfsffpkdlcpvprswiattgn
lvffrdhaegghfaalerprelktdltafveqvw

Sequence, based on observed residues (ATOM records): (download)

>d1qo7b_ c.69.1.11 (B:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}
kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
ltesfpraihtyrettpmlqkelyihkpfgfsffpkdlcpvprswiattgnlvffrdhae
gghfaalerprelktdltafveqvw

SCOPe Domain Coordinates for d1qo7b_:

Click to download the PDB-style file with coordinates for d1qo7b_.
(The format of our PDB-style files is described here.)

Timeline for d1qo7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qo7a_