Lineage for d5o22c1 (5o22 C:2-122)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890462Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
    automatically mapped to Pfam PF00763
  6. 2890484Protein automated matches [346970] (1 species)
    not a true protein
  7. 2890485Species Escherichia coli [TaxId:83333] [346971] (3 PDB entries)
  8. 2890496Domain d5o22c1: 5o22 C:2-122 [346972]
    Other proteins in same PDB: d5o22a2, d5o22b2, d5o22b3, d5o22c2, d5o22d2, d5o22d3
    automated match to d1b0aa2
    complexed with c3r

Details for d5o22c1

PDB Entry: 5o22 (more details), 2.1 Å

PDB Description: e. coli fold in complex with carolacton
PDB Compounds: (C:) Bifunctional protein folD

SCOPe Domain Sequences for d5o22c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o22c1 c.58.1.2 (C:2-122) automated matches {Escherichia coli [TaxId: 83333]}
aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev
gfvsrsydlpettseaellelidtlnadntidgilvqlplpagidnvkvlerihpdkdvd
g

SCOPe Domain Coordinates for d5o22c1:

Click to download the PDB-style file with coordinates for d5o22c1.
(The format of our PDB-style files is described here.)

Timeline for d5o22c1: