SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1qo7a_ (1qo7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134816Family c.69.1.11: Epoxide hydrolase [53525] (3 protein domains)
  6. 2134817Protein Bacterial epoxide hydrolase [53528] (2 species)
  7. 2134823Species Aspergillus niger [TaxId:5061] [53530] (3 PDB entries)
  8. 2134826Domain d1qo7a_: 1qo7 A: [34697]

Details for d1qo7a_

PDB Entry: 1qo7 (more details), 1.8 Å

PDB Description: structure of aspergillus niger epoxide hydrolase
PDB Compounds: (A:) epoxide hydrolase

SCOPe Domain Sequences for d1qo7a_:

Sequence, based on SEQRES records: (download)

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}
kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
ltesfpraihtyrettptasapngatmlqkelyihkpfgfsffpkdlcpvprswiattgn
lvffrdhaegghfaalerprelktdltafveqvw

Sequence, based on observed residues (ATOM records): (download)

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}
kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
ltesfpraihtyrettpmlqkelyihkpfgfsffpkdlcpvprswiattgnlvffrdhae
gghfaalerprelktdltafveqvw

SCOPe Domain Coordinates for d1qo7a_:

Click to download the PDB-style file with coordinates for d1qo7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qo7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qo7b_