Lineage for d5nrmb_ (5nrm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347539Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2347540Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2347558Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2347559Protein automated matches [190928] (7 species)
    not a true protein
  7. 2347560Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries)
  8. 2347561Domain d5nrmb_: 5nrm B: [346968]
    Other proteins in same PDB: d5nrma1, d5nrma2
    automated match to d4uypb_
    complexed with ca; mutant

Details for d5nrmb_

PDB Entry: 5nrm (more details), 1.4 Å

PDB Description: crystal structure of the sixth cohesin from acetivibrio cellulolyticus' scaffoldin b in complex with cel5 dockerin s51i, l52n mutant
PDB Compounds: (B:) DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S51I, L52N mutant

SCOPe Domain Sequences for d5nrmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nrmb_ a.139.1.0 (B:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
kpgdvdgngsinsidfalmrnyllgnlkdfpaeddikagdlngdksinindfaimrmyll
gmitkf

SCOPe Domain Coordinates for d5nrmb_:

Click to download the PDB-style file with coordinates for d5nrmb_.
(The format of our PDB-style files is described here.)

Timeline for d5nrmb_: