Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.0: automated matches [267625] (1 protein) not a true family |
Protein automated matches [267676] (11 species) not a true protein |
Species Providencia stuartii [TaxId:588] [311523] (4 PDB entries) |
Domain d5nxrb_: 5nxr B: [346967] automated match to d4d65a_ complexed with ca, cl, lda |
PDB Entry: 5nxr (more details), 2.7 Å
SCOPe Domain Sequences for d5nxrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nxrb_ f.4.3.0 (B:) automated matches {Providencia stuartii [TaxId: 588]} aevynkdgnkldvygkvdvrhyfasadkgkksedgddsrvrlgvkgdtqitdqltgfgrf ewetktnkaenegenknrlayaglkfadfgsidygrnygvvydtnawtdvfplwgadtma qtdnfmtsrnrnlltyrnnnafgyvdglsfalqyqgkngdnnkssagmakdngdgygfst ayelgwgvtlgggyssssrtpnqkagvvtsegdsyysatgkraqawnvggkfdannvyla amygqtqntsrygdldlianktenvelvaqylfdfglkpsigynqskgknlgngydnqdl vkyisvgsyyyfnknmsavvdykinllkdndftkeygintdnvlglglvyqf
Timeline for d5nxrb_: