SCOPe 2.08: Domain d5nufc1: 5nuf C:2-156

Lineage for d5nufc1 (5nuf C:2-156)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries)

8. Domain d5nufc1: 5nuf C:2-156 [346962]
   Other proteins in same PDB: d5nufa2, d5nufb2, d5nufc2
   automated match to d5mdha1
   complexed with act, edo, fmt, gol, na, nad, peg, peo, so4

Details for d5nufc1

PDB Entry: 5nuf, 1.8 Å

PDB Description: cytosolic malate dehydrogenase 1

PDB Compounds: (C:) Malate dehydrogenase 1, cytoplasmic

SCOPe Domain Sequences for d5nufc1:

Sequence; same for both SEQRES and ATOM records:

>d5nufc1 c.2.1.0 (C:2-156) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
akepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelida
afpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekha
apnckvlvvanpantnalilkefapsipekniscl

Timeline for d5nufc1:

• d5nufc1 first appeared in SCOPe 2.07