Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries) |
Domain d5nufc1: 5nuf C:2-156 [346962] Other proteins in same PDB: d5nufa2, d5nufb2, d5nufc2 automated match to d5mdha1 complexed with act, edo, fmt, gol, na, nad, peg, peo, so4 |
PDB Entry: 5nuf (more details), 1.8 Å
SCOPe Domain Sequences for d5nufc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nufc1 c.2.1.0 (C:2-156) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} akepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelida afpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekha apnckvlvvanpantnalilkefapsipekniscl
Timeline for d5nufc1:
View in 3D Domains from other chains: (mouse over for more information) d5nufa1, d5nufa2, d5nufb1, d5nufb2 |