Lineage for d5nu7a_ (5nu7 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein Retinol binding protein [50816] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50819] (17 PDB entries)
  8. Domain d5nu7a_: 5nu7 A: [346960]
    automated match to d1brpa_
    complexed with cl, rtl

Details for d5nu7a_

PDB Entry: 5nu7 (more details), 1.5 Å

PDB Description: structure of human holo plasma rbp4
PDB Compounds: (A:) retinol-binding protein 4

SCOPe Domain Sequences for d5nu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nu7a_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd

SCOPe Domain Coordinates for d5nu7a_ are not available.

Timeline for d5nu7a_: