Lineage for d1ehyd_ (1ehy D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869781Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 1869782Protein Bacterial epoxide hydrolase [53528] (2 species)
  7. 1869783Species Agrobacterium radiobacter [TaxId:358] [53529] (1 PDB entry)
  8. 1869787Domain d1ehyd_: 1ehy D: [34696]
    complexed with k

Details for d1ehyd_

PDB Entry: 1ehy (more details), 2.1 Å

PDB Description: X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
PDB Compounds: (D:) protein (soluble epoxide hydrolase)

SCOPe Domain Sequences for d1ehyd_:

Sequence, based on SEQRES records: (download)

>d1ehyd_ c.69.1.11 (D:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}
airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
drvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhffd
hwsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmi
wglgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr

Sequence, based on observed residues (ATOM records): (download)

>d1ehyd_ c.69.1.11 (D:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}
airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
drvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdellte
eelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpya
pliefvpkyysnytmetiedcghflmvekpeiaidriktafr

SCOPe Domain Coordinates for d1ehyd_:

Click to download the PDB-style file with coordinates for d1ehyd_.
(The format of our PDB-style files is described here.)

Timeline for d1ehyd_: