| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
| Protein automated matches [190248] (6 species) not a true protein |
| Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (3 PDB entries) |
| Domain d5nrma1: 5nrm A:2-140 [346952] Other proteins in same PDB: d5nrma2, d5nrmb_ automated match to d2vn5a_ complexed with ca; mutant |
PDB Entry: 5nrm (more details), 1.4 Å
SCOPe Domain Sequences for d5nrma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nrma1 b.2.2.2 (A:2-140) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
tgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivtnp
gvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgtpt
fgdstltpvvakvtngavn
Timeline for d5nrma1: