Lineage for d5nq6a_ (5nq6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007689Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 3007697Protein automated matches [191012] (4 species)
    not a true protein
  7. 3007704Species Escherichia coli [TaxId:83333] [326403] (2 PDB entries)
  8. 3007705Domain d5nq6a_: 5nq6 A: [346951]
    Other proteins in same PDB: d5nq6b2
    automated match to d4lw4c_
    complexed with gol, so4

Details for d5nq6a_

PDB Entry: 5nq6 (more details), 2.4 Å

PDB Description: crystal structure of the inhibited form of the redox-sensitive sufe- like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution
PDB Compounds: (A:) sulfur acceptor protein csde

SCOPe Domain Sequences for d5nq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nq6a_ d.224.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvw
lgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqls
asrsqglnalseaiiaatkqv

SCOPe Domain Coordinates for d5nq6a_:

Click to download the PDB-style file with coordinates for d5nq6a_.
(The format of our PDB-style files is described here.)

Timeline for d5nq6a_: