Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.1: SufE-like [82650] (3 proteins) Fe-S metabolism associated domain automatically mapped to Pfam PF02657 |
Protein automated matches [191012] (4 species) not a true protein |
Species Escherichia coli [TaxId:83333] [326403] (2 PDB entries) |
Domain d5nq6a_: 5nq6 A: [346951] Other proteins in same PDB: d5nq6b2 automated match to d4lw4c_ complexed with gol, so4 |
PDB Entry: 5nq6 (more details), 2.4 Å
SCOPe Domain Sequences for d5nq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nq6a_ d.224.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]} aghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvw lgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqls asrsqglnalseaiiaatkqv
Timeline for d5nq6a_: