| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (27 species) not a true protein |
| Species Thalassiosira antarctica [TaxId:555753] [346598] (1 PDB entry) |
| Domain d5mz2d1: 5mz2 D:3-153 [346948] Other proteins in same PDB: d5mz2a2, d5mz2b2, d5mz2c2, d5mz2d2, d5mz2e2, d5mz2f2, d5mz2g2, d5mz2h2, d5mz2i_, d5mz2j_, d5mz2k_, d5mz2l_, d5mz2m_, d5mz2n_, d5mz2o_, d5mz2p_ automated match to d1bwva2 complexed with cap, edo, mg |
PDB Entry: 5mz2 (more details), 1.9 Å
SCOPe Domain Sequences for d5mz2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mz2d1 d.58.9.0 (D:3-153) automated matches {Thalassiosira antarctica [TaxId: 555753]}
qsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaava
gesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnlta
siignvfgfkaisalrledmriphsylxtfq
Timeline for d5mz2d1: