Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein automated matches [190248] (6 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (3 PDB entries) |
Domain d5nrka1: 5nrk A:0-140 [346943] Other proteins in same PDB: d5nrka2, d5nrkb_, d5nrkc2, d5nrkd_ automated match to d2vn5a_ complexed with ca, gol, scn; mutant |
PDB Entry: 5nrk (more details), 1.45 Å
SCOPe Domain Sequences for d5nrka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nrka1 b.2.2.2 (A:0-140) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} mqtgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivt npgvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgt ptfgdstltpvvakvtngavn
Timeline for d5nrka1:
View in 3D Domains from other chains: (mouse over for more information) d5nrkb_, d5nrkc1, d5nrkc2, d5nrkd_ |