Lineage for d5nr7b_ (5nr7 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474359Protein Thymidylate kinase [52563] (5 species)
  7. 2474410Species Mycobacterium tuberculosis [TaxId:83332] [346929] (5 PDB entries)
  8. 2474418Domain d5nr7b_: 5nr7 B: [346937]
    automated match to d1gsia_
    complexed with cl, yui

Details for d5nr7b_

PDB Entry: 5nr7 (more details), 2.35 Å

PDB Description: mtb tmk crystal structure in complex with compound 43
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5nr7b_:

Sequence, based on SEQRES records: (download)

>d5nr7b_ c.37.1.1 (B:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 83332]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

Sequence, based on observed residues (ATOM records): (download)

>d5nr7b_ c.37.1.1 (B:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 83332]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsrdaelqqrtgavyaelaaqgwggrwlvvgadvdpgrla
atla

SCOPe Domain Coordinates for d5nr7b_:

Click to download the PDB-style file with coordinates for d5nr7b_.
(The format of our PDB-style files is described here.)

Timeline for d5nr7b_: