Lineage for d5ncpa_ (5ncp A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. Protein automated matches [226957] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries)
  8. Domain d5ncpa_: 5ncp A: [346936]
    automated match to d2iyba_
    complexed with eg5, no3, so4

Details for d5ncpa_

PDB Entry: 5ncp (more details), 1.6500000000000001 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-12]-oh
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d5ncpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ncpa_ b.55.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvinc
aipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d5ncpa_ are not available.

Timeline for d5ncpa_: