Lineage for d5mk8a2 (5mk8 A:1072-1288)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385683Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2385726Protein automated matches [229100] (5 species)
    not a true protein
  7. 2385727Species Clostridium botulinum [TaxId:1491] [229101] (14 PDB entries)
  8. 3046873Domain d5mk8a2: 5mk8 A:1072-1288 [346935]
    Other proteins in same PDB: d5mk8a1, d5mk8b1
    automated match to d5v38a2
    complexed with cl, fmt

Details for d5mk8a2

PDB Entry: 5mk8 (more details), 1.95 Å

PDB Description: crystal structure of the receptor-binding domain of the fa hybrid clostridium botulinum neurotoxin
PDB Compounds: (A:) Botulinum neurotoxin FA binding domain

SCOPe Domain Sequences for d5mk8a2:

Sequence, based on SEQRES records: (download)

>d5mk8a2 b.42.4.2 (A:1072-1288) automated matches {Clostridium botulinum [TaxId: 1491]}
nkkeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyldvnnvgirgymylkgp
rgrivttniylnstlymgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaveipdvgnlsqvvvmksendqgirnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqigkasrtfgcswefipvddgwgessl

Sequence, based on observed residues (ATOM records): (download)

>d5mk8a2 b.42.4.2 (A:1072-1288) automated matches {Clostridium botulinum [TaxId: 1491]}
nkkeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyldvnnvgirgymylkgp
rgrivttniylnstlymgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaveipdvgnlsqvvvmksenkckmnlqdnngndigfigfhqfnniaklvasn
wynrqigkasrtfgcswefipvddgwgessl

SCOPe Domain Coordinates for d5mk8a2:

Click to download the PDB-style file with coordinates for d5mk8a2.
(The format of our PDB-style files is described here.)

Timeline for d5mk8a2:

  • d5mk8a2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5mk8a1