Lineage for d5nuaa_ (5nua A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414230Protein Retinol binding protein [50816] (5 species)
  7. 2414248Species Human (Homo sapiens) [TaxId:9606] [50819] (17 PDB entries)
  8. 2414255Domain d5nuaa_: 5nua A: [346933]
    automated match to d1brpa_
    complexed with cl, dao

Details for d5nuaa_

PDB Entry: 5nua (more details), 1.6 Å

PDB Description: structure of human urine rbp4 saturated with laurate
PDB Compounds: (A:) retinol-binding protein 4

SCOPe Domain Sequences for d5nuaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nuaa_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd

SCOPe Domain Coordinates for d5nuaa_:

Click to download the PDB-style file with coordinates for d5nuaa_.
(The format of our PDB-style files is described here.)

Timeline for d5nuaa_: