Lineage for d5nrkd_ (5nrk D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734507Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2734508Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2734526Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2734527Protein automated matches [190928] (7 species)
    not a true protein
  7. 2734528Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries)
  8. 2734531Domain d5nrkd_: 5nrk D: [346928]
    Other proteins in same PDB: d5nrka1, d5nrka2, d5nrkc1, d5nrkc2
    automated match to d4uyqb_
    complexed with ca, gol, scn; mutant

Details for d5nrkd_

PDB Entry: 5nrk (more details), 1.45 Å

PDB Description: crystal structure of the sixth cohesin from acetivibrio cellulolyticus' scaffoldin b in complex with cel5 dockerin s15i, i16n mutant
PDB Compounds: (D:) DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S15I, I16N mutant

SCOPe Domain Sequences for d5nrkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nrkd_ a.139.1.0 (D:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
kpgdvdgngsinindfalmrnyllgnlkdfpaeddikagdlngdksinsldfaimrmyll
gmitkfs

SCOPe Domain Coordinates for d5nrkd_:

Click to download the PDB-style file with coordinates for d5nrkd_.
(The format of our PDB-style files is described here.)

Timeline for d5nrkd_: