Lineage for d5npna_ (5npn A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032326Protein automated matches [190676] (9 species)
    not a true protein
  7. 3032350Species Naja oxiana [TaxId:8657] [254885] (6 PDB entries)
  8. 3032353Domain d5npna_: 5npn A: [346927]
    automated match to d5t8aa_

Details for d5npna_

PDB Entry: 5npn (more details)

PDB Description: refined structure of cytotoxin i
PDB Compounds: (A:) Cytotoxin 1

SCOPe Domain Sequences for d5npna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5npna_ g.7.1.1 (A:) automated matches {Naja oxiana [TaxId: 8657]}
lkcnklvpiayktcpegknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn

SCOPe Domain Coordinates for d5npna_:

Click to download the PDB-style file with coordinates for d5npna_.
(The format of our PDB-style files is described here.)

Timeline for d5npna_: