Lineage for d5nrkc1 (5nrk C:0-140)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377050Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2377133Protein automated matches [190248] (6 species)
    not a true protein
  7. 2377134Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (3 PDB entries)
  8. 2377138Domain d5nrkc1: 5nrk C:0-140 [346914]
    Other proteins in same PDB: d5nrka2, d5nrkb_, d5nrkc2, d5nrkd_
    automated match to d2vn5a_
    complexed with ca, gol, scn; mutant

Details for d5nrkc1

PDB Entry: 5nrk (more details), 1.45 Å

PDB Description: crystal structure of the sixth cohesin from acetivibrio cellulolyticus' scaffoldin b in complex with cel5 dockerin s15i, i16n mutant
PDB Compounds: (C:) endoglucanase

SCOPe Domain Sequences for d5nrkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nrkc1 b.2.2.2 (C:0-140) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
mqtgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivt
npgvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgt
ptfgdstltpvvakvtngavn

SCOPe Domain Coordinates for d5nrkc1:

Click to download the PDB-style file with coordinates for d5nrkc1.
(The format of our PDB-style files is described here.)

Timeline for d5nrkc1: