SCOPe 2.08: Domain d5nrkc1: 5nrk C:0-140

Lineage for d5nrkc1 (5nrk C:0-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (6 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (3 PDB entries)

8. Domain d5nrkc1: 5nrk C:0-140 [346914]
   Other proteins in same PDB: d5nrka2, d5nrkb_, d5nrkc2, d5nrkd_
   automated match to d2vn5a_
   complexed with ca, gol, scn; mutant

Details for d5nrkc1

PDB Entry: 5nrk, 1.45 Å

PDB Description: crystal structure of the sixth cohesin from acetivibrio cellulolyticus' scaffoldin b in complex with cel5 dockerin s15i, i16n mutant

PDB Compounds: (C:) endoglucanase

SCOPe Domain Sequences for d5nrkc1:

Sequence; same for both SEQRES and ATOM records:

>d5nrkc1 b.2.2.2 (C:0-140) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
mqtgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivt
npgvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgt
ptfgdstltpvvakvtngavn

Timeline for d5nrkc1:

• d5nrkc1 first appeared in SCOPe 2.07