SCOPe 2.08: Domain d5n62b_: 5n62 B:

Lineage for d5n62b_ (5n62 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein automated matches [190376] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries)

8. Domain d5n62b_: 5n62 B: [346913]
   automated match to d1roya_
   complexed with mn

Details for d5n62b_

PDB Entry: 5n62, 1.8 Å

PDB Description: human ttr crystals soaked in manganese chloride.

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5n62b_:

Sequence; same for both SEQRES and ATOM records:

>d5n62b_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d5n62b_:

• d5n62b_ first appeared in SCOPe 2.07